Lineage for d4jvre_ (4jvr E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270168Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1270169Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1270170Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1270177Protein MDM2 [47594] (2 species)
  7. 1270190Species Human (Homo sapiens) [TaxId:9606] [47596] (36 PDB entries)
  8. 1270210Domain d4jvre_: 4jvr E: [202810]
    automated match to d4jvra_
    complexed with 1mt

Details for d4jvre_

PDB Entry: 4jvr (more details), 1.7 Å

PDB Description: Co-crystal structure of MDM2 with inhibitor (2'S,3R,4'S,5'R)-N-(2-aminoethyl)-6-chloro-4'-(3-chloro-2-fluorophenyl)-2'-(2,2-dimethylpropyl)-2-oxo-1,2-dihydrospiro[indole-3,3'-pyrrolidine]-5'-carboxamide
PDB Compounds: (E:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4jvre_:

Sequence, based on SEQRES records: (download)

>d4jvre_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Sequence, based on observed residues (ATOM records): (download)

>d4jvre_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgqkdtytmkevlfylgqyimtkrlydqhivycsndll
gdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4jvre_:

Click to download the PDB-style file with coordinates for d4jvre_.
(The format of our PDB-style files is described here.)

Timeline for d4jvre_: