Lineage for d4jvpb_ (4jvp B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758808Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)
  8. 1758817Domain d4jvpb_: 4jvp B: [202808]
    automated match to d4jvpa_
    complexed with so4

Details for d4jvpb_

PDB Entry: 4jvp (more details), 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03
PDB Compounds: (B:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpb_:

Sequence, based on SEQRES records: (download)

>d4jvpb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyyad
svksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgtq
vtvssaaale

Sequence, based on observed residues (ATOM records): (download)

>d4jvpb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctagftddyyaigwfrqapgkeregvscitnfdggtyyads
vksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlrakvtfgswgqgtqvtv
ssaaale

SCOPe Domain Coordinates for d4jvpb_:

Click to download the PDB-style file with coordinates for d4jvpb_.
(The format of our PDB-style files is described here.)

Timeline for d4jvpb_: