SCOPe 2.08: Domain d4jvpb1: 4jvp B:3-127

Lineage for d4jvpb1 (4jvp B:3-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d4jvpb1: 4jvp B:3-127 [202808]
   Other proteins in same PDB: d4jvpa2, d4jvpb2
   automated match to d4jvpa_
   complexed with so4

Details for d4jvpb1

PDB Entry: 4jvp, 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03

PDB Compounds: (B:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpb1:

Sequence, based on SEQRES records:

>d4jvpb1 b.1.1.1 (B:3-127) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyyad
svksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgtq
vtvss

Sequence, based on observed residues (ATOM records):

>d4jvpb1 b.1.1.1 (B:3-127) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctagftddyyaigwfrqapgkeregvscitnfdggtyyads
vksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlrakvtfgswgqgtqvtv
ss

Timeline for d4jvpb1:

• d4jvpb1 first appeared in SCOPe 2.03, called d4jvpb_
  
• d4jvpb1 appears in SCOPe 2.07