Lineage for d4jvpb1 (4jvp B:3-127)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745493Domain d4jvpb1: 4jvp B:3-127 [202808]
    Other proteins in same PDB: d4jvpa2, d4jvpb2
    automated match to d4jvpa_
    complexed with so4

Details for d4jvpb1

PDB Entry: 4jvp (more details), 1.76 Å

PDB Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03
PDB Compounds: (B:) Anti-HCV E2 alpaca nanobody D03

SCOPe Domain Sequences for d4jvpb1:

Sequence, based on SEQRES records: (download)

>d4jvpb1 b.1.1.1 (B:3-127) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyyad
svksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgtq
vtvss

Sequence, based on observed residues (ATOM records): (download)

>d4jvpb1 b.1.1.1 (B:3-127) automated matches {Vicugna pacos [TaxId: 30538]}
qlqasggglvqpggslrlsctagftddyyaigwfrqapgkeregvscitnfdggtyyads
vksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlrakvtfgswgqgtqvtv
ss

SCOPe Domain Coordinates for d4jvpb1:

Click to download the PDB-style file with coordinates for d4jvpb1.
(The format of our PDB-style files is described here.)

Timeline for d4jvpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jvpb2