![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
![]() | Domain d4jugc1: 4jug C:5-325 [202803] Other proteins in same PDB: d4juga2, d4jugb_, d4jugc2, d4jugd_, d4juge2, d4jugf_, d4jugg2, d4jugh_, d4jugi2, d4jugj_, d4jugk2, d4jugl_ automated match to d4juga_ mutant |
PDB Entry: 4jug (more details), 2.7 Å
SCOPe Domain Sequences for d4jugc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jugc1 b.19.1.2 (C:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti gecpkyvrstklrmatglrnip
Timeline for d4jugc1: