Lineage for d4ju0k_ (4ju0 K:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040585Domain d4ju0k_: 4ju0 K: [202802]
    Other proteins in same PDB: d4ju0b_, d4ju0d_, d4ju0f_, d4ju0h_, d4ju0j_, d4ju0l_
    automated match to d4ju0a_
    complexed with nag, sia; mutant

Details for d4ju0k_

PDB Entry: 4ju0 (more details), 2.91 Å

PDB Description: Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E complexed with human receptor analogue LSTc
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d4ju0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ju0k_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

SCOPe Domain Coordinates for d4ju0k_:

Click to download the PDB-style file with coordinates for d4ju0k_.
(The format of our PDB-style files is described here.)

Timeline for d4ju0k_: