Lineage for d1bvkb_ (1bvk B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510451Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1510531Domain d1bvkb_: 1bvk B: [20279]
    Other proteins in same PDB: d1bvka_, d1bvkc_, d1bvkd_, d1bvkf_
    part of humanized anti-lysozyme Fv HuLys11

Details for d1bvkb_

PDB Entry: 1bvk (more details), 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme
PDB Compounds: (B:) hulys11

SCOPe Domain Sequences for d1bvkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvkb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

SCOPe Domain Coordinates for d1bvkb_:

Click to download the PDB-style file with coordinates for d1bvkb_.
(The format of our PDB-style files is described here.)

Timeline for d1bvkb_: