Lineage for d1bvkb_ (1bvk B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220053Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries)
  8. 220055Domain d1bvkb_: 1bvk B: [20279]
    Other proteins in same PDB: d1bvkc_, d1bvkf_

Details for d1bvkb_

PDB Entry: 1bvk (more details), 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme
PDB Compounds: (B:)

SCOP Domain Sequences for d1bvkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvkb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

SCOP Domain Coordinates for d1bvkb_:

Click to download the PDB-style file with coordinates for d1bvkb_.
(The format of our PDB-style files is described here.)

Timeline for d1bvkb_: