SCOPe 2.08: Domain d4jsup_: 4jsu P:

Lineage for d4jsup_ (4jsu P:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d4jsup_: 4jsu P: [202787]
   Other proteins in same PDB: d4jsua_, d4jsuc2, d4jsue_, d4jsui_, d4jsuj_, d4jsuk_, d4jsul_, d4jsum_, d4jsun_, d4jsuo_, d4jsuq2, d4jsus_, d4jsuw_, d4jsux_, d4jsuy_, d4jsuz_
   automated match to d2zcyb_
   complexed with mes

Details for d4jsup_

PDB Entry: 4jsu, 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:3a

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4jsup_:

Sequence; same for both SEQRES and ATOM records:

>d4jsup_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4jsup_:

• d4jsup_ first appeared in SCOPe 2.03
  
• d4jsup_ appears in SCOPe 2.07