Lineage for d4jsqj_ (4jsq J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1935372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1936213Domain d4jsqj_: 4jsq J: [202762]
    Other proteins in same PDB: d4jsqb_, d4jsqc_, d4jsqd_, d4jsqe_, d4jsqf_, d4jsqg_, d4jsqh_, d4jsqk_, d4jsqp_, d4jsqq_, d4jsqr_, d4jsqs_, d4jsqt_, d4jsqu_, d4jsqv_, d4jsqy_
    automated match to d1rypk_
    complexed with mes

Details for d4jsqj_

PDB Entry: 4jsq (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e
PDB Compounds: (J:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4jsqj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jsqj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

SCOPe Domain Coordinates for d4jsqj_:

Click to download the PDB-style file with coordinates for d4jsqj_.
(The format of our PDB-style files is described here.)

Timeline for d4jsqj_: