SCOPe 2.08: Domain d4jrra1: 4jrr A:33-216

Lineage for d4jrra1 (4jrr A:33-216)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [196919] (2 PDB entries)

8. Domain d4jrra1: 4jrr A:33-216 [202753]
   Other proteins in same PDB: d4jrra2
   automated match to d4jrrb_
   complexed with gol, so4

Details for d4jrra1

PDB Entry: 4jrr, 1.88 Å

PDB Description: crystal structure of disulfide bond oxidoreductase dsba1 from legionella pneumophila

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d4jrra1:

Sequence; same for both SEQRES and ATOM records:

>d4jrra1 c.47.1.0 (A:33-216) automated matches {Legionella pneumophila [TaxId: 272624]}
qfiegkdyqtvasaqlstnkdktpliteffsygcpwcykidaplndwatrmgkgahlerv
pvvfkpnwdlyakayytaktlamsdkmnpilfkaiqedknplatkqsmvdffvahgvdre
iaksafensptidmrvnsgmslmahyqinavpafvvnnkyktdlqmagseerlfeilnyl
vrks

Timeline for d4jrra1:

• d4jrra1 first appeared in SCOPe 2.03, called d4jrra_
  
• d4jrra1 appears in SCOPe 2.07