Lineage for d2hmid1 (2hmi D:1-123)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547173Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
  8. 547182Domain d2hmid1: 2hmi D:1-123 [20275]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic1, d2hmic2, d2hmid2
    part of Fab 28 against HIV-1 RT
    protein/protein/DNA complex; mutant

Details for d2hmid1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex
PDB Compounds: (D:)

SCOP Domain Sequences for d2hmid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmid1 b.1.1.1 (D:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d2hmid1:

Click to download the PDB-style file with coordinates for d2hmid1.
(The format of our PDB-style files is described here.)

Timeline for d2hmid1: