Lineage for d4jetf_ (4jet F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901437Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1901438Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 1901456Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 1901457Protein automated matches [196914] (3 species)
    not a true protein
  7. 1901461Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries)
  8. 1901470Domain d4jetf_: 4jet F: [202742]
    automated match to d4jeta_
    complexed with cl, hem

Details for d4jetf_

PDB Entry: 4jet (more details), 2.2 Å

PDB Description: 2.2a resolution structure of holo hemophore hasa from yersinia pestis
PDB Compounds: (F:) hemophore hasa

SCOPe Domain Sequences for d4jetf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jetf_ d.35.1.0 (F:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd

SCOPe Domain Coordinates for d4jetf_:

Click to download the PDB-style file with coordinates for d4jetf_.
(The format of our PDB-style files is described here.)

Timeline for d4jetf_: