| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) ![]() |
| Family d.35.1.0: automated matches [196913] (1 protein) not a true family |
| Protein automated matches [196914] (3 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [196915] (3 PDB entries) |
| Domain d4jetb_: 4jet B: [202741] automated match to d4jeta_ complexed with cl, hem |
PDB Entry: 4jet (more details), 2.2 Å
SCOPe Domain Sequences for d4jetb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jetb_ d.35.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkysfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd
Timeline for d4jetb_: