Lineage for d2hmic1 (2hmi C:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288237Domain d2hmic1: 2hmi C:1-107 [20274]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic2, d2hmid1, d2hmid2
    part of Fab 28 against HIV-1 RT
    protein/protein/DNA complex; mutant

Details for d2hmic1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmic1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d2hmic1:

Click to download the PDB-style file with coordinates for d2hmic1.
(The format of our PDB-style files is described here.)

Timeline for d2hmic1: