SCOP 1.63: Domain d2hmic1: 2hmi C:1-107

Lineage for d2hmic1 (2hmi C:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)

8. Domain d2hmic1: 2hmi C:1-107 [20274]
   Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic2, d2hmid2

Details for d2hmic1

PDB Entry: 2hmi, 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmic1:

Sequence; same for both SEQRES and ATOM records:

>d2hmic1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

Timeline for d2hmic1:

• d2hmic1 first appeared (with stable ids) in SCOP 1.55
  
• d2hmic1 appears in SCOP 1.61
  
• d2hmic1 appears in SCOP 1.65
  
• d2hmic1 appears in the current release, SCOPe 2.08