Lineage for d2hmic1 (2hmi C:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7382Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (2 PDB entries)
  8. 7383Domain d2hmic1: 2hmi C:1-107 [20274]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib1, d2hmic2, d2hmid2

Details for d2hmic1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex
PDB Compounds: (C:)

SCOP Domain Sequences for d2hmic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmic1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d2hmic1:

Click to download the PDB-style file with coordinates for d2hmic1.
(The format of our PDB-style files is described here.)

Timeline for d2hmic1: