Lineage for d4jctf_ (4jct F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099100Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2099280Protein automated matches [190149] (9 species)
    not a true protein
  7. 2099429Species Listeria monocytogenes [TaxId:169963] [197321] (1 PDB entry)
  8. 2099435Domain d4jctf_: 4jct F: [202736]
    automated match to d4jctc_

Details for d4jctf_

PDB Entry: 4jct (more details), 2.6 Å

PDB Description: ClpP2 from Listeria monocytogenes
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4jctf_:

Sequence, based on SEQRES records: (download)

>d4jctf_ c.14.1.1 (F:) automated matches {Listeria monocytogenes [TaxId: 169963]}
liptvieqtsrgeraydiysrllkdriimlgsaiddnvansivsqllfldaqdpekdifl
yinspggsisagmaiydtmnfvkadvqtigmgmaasmgsflltagangkrfalpnaeimi
hqplggaqgqateieiaarhilkikermntimaektgqpyeviardtdrdnfmtaqeakd
ygliddiiink

Sequence, based on observed residues (ATOM records): (download)

>d4jctf_ c.14.1.1 (F:) automated matches {Listeria monocytogenes [TaxId: 169963]}
liptvieaydiysrllkdriimlgsaiddnvansivsqllfldaqdpekdiflyinspgg
sisagmaiydtmnfvkadvqtigmgmaasmgsflltagangkrfalpnaeimihqplgga
qgqateieiaarhilkikermntimaektgqpyeviardtdrdnfmtaqeakdygliddi
iink

SCOPe Domain Coordinates for d4jctf_:

Click to download the PDB-style file with coordinates for d4jctf_.
(The format of our PDB-style files is described here.)

Timeline for d4jctf_: