Lineage for d4ja8a_ (4ja8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386193Protein automated matches [190072] (18 species)
    not a true protein
  7. 1386264Species Human (Homo sapiens) [TaxId:9606] [189131] (7 PDB entries)
  8. 1386265Domain d4ja8a_: 4ja8 A: [202723]
    automated match to d4ja8b_
    complexed with 1k9, ca, gol, ndp; mutant

Details for d4ja8a_

PDB Entry: 4ja8 (more details), 1.55 Å

PDB Description: complex of mitochondrial isocitrate dehydrogenase r140q mutant with agi-6780 inhibitor
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d4ja8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ja8a_ c.77.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqhhhh

SCOPe Domain Coordinates for d4ja8a_:

Click to download the PDB-style file with coordinates for d4ja8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ja8a_: