SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ja8a1 (4ja8 A:41-452)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138768Protein automated matches [190072] (19 species)
    not a true protein
  7. 2138837Species Human (Homo sapiens) [TaxId:9606] [189131] (3 PDB entries)
  8. 2138838Domain d4ja8a1: 4ja8 A:41-452 [202723]
    Other proteins in same PDB: d4ja8a2
    automated match to d4ja8b_
    complexed with 1k9, ca, gol, ndp; mutant

Details for d4ja8a1

PDB Entry: 4ja8 (more details), 1.55 Å

PDB Description: Complex of Mitochondrial Isocitrate Dehydrogenase R140Q Mutant with AGI-6780 Inhibitor
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d4ja8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ja8a1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq

SCOPe Domain Coordinates for d4ja8a1:

Click to download the PDB-style file with coordinates for d4ja8a1.
(The format of our PDB-style files is described here.)

Timeline for d4ja8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ja8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4ja8b_