Lineage for d4j7kc_ (4j7k C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1730421Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1730435Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 1730436Protein automated matches [193225] (4 species)
    not a true protein
  7. 1730437Species Bacillus anthracis [TaxId:260799] [193226] (8 PDB entries)
  8. 1730456Domain d4j7kc_: 4j7k C: [202721]
    automated match to d4j7kd_
    mutant

Details for d4j7kc_

PDB Entry: 4j7k (more details), 1.66 Å

PDB Description: The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
PDB Compounds: (C:) Secreted protein EsxB

SCOPe Domain Sequences for d4j7kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j7kc_ a.25.3.0 (C:) automated matches {Bacillus anthracis [TaxId: 260799]}
amaeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgqfiqsk
qamqqyipilegistdlkriadkfrntdnay

SCOPe Domain Coordinates for d4j7kc_:

Click to download the PDB-style file with coordinates for d4j7kc_.
(The format of our PDB-style files is described here.)

Timeline for d4j7kc_: