Lineage for d4j7kc1 (4j7k C:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705332Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2705346Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2705347Protein automated matches [193225] (4 species)
    not a true protein
  7. 2705348Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries)
  8. 2705373Domain d4j7kc1: 4j7k C:1-90 [202721]
    Other proteins in same PDB: d4j7ka2, d4j7kb2, d4j7kc2
    automated match to d4j7kd_
    mutant

Details for d4j7kc1

PDB Entry: 4j7k (more details), 1.66 Å

PDB Description: The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
PDB Compounds: (C:) Secreted protein EsxB

SCOPe Domain Sequences for d4j7kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j7kc1 a.25.3.0 (C:1-90) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgqfiqskq
amqqyipilegistdlkriadkfrntdnay

SCOPe Domain Coordinates for d4j7kc1:

Click to download the PDB-style file with coordinates for d4j7kc1.
(The format of our PDB-style files is described here.)

Timeline for d4j7kc1: