Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
Domain d1adql1: 1adq L:2-107 [20272] Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adqh2, d1adql2 part of IgM rheumatoid factor Fab |
PDB Entry: 1adq (more details), 3.15 Å
SCOP Domain Sequences for d1adql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adql1 b.1.1.1 (L:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrppgiperf sgsnsgntatltisrveagdeadyycqvwdsssdhavfgggtkltvlg
Timeline for d1adql1:
View in 3D Domains from other chains: (mouse over for more information) d1adqa1, d1adqa2, d1adqh1, d1adqh2 |