SCOP 1.75: Domain d1adql1: 1adq L:2-107

Lineage for d1adql1 (1adq L:2-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1adql1: 1adq L:2-107 [20272]
   Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adqh2, d1adql2
   part of IgM rheumatoid factor Fab

Details for d1adql1

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

PDB Compounds: (L:) igm-lambda rf-an fab (light chain)

SCOP Domain Sequences for d1adql1:

Sequence; same for both SEQRES and ATOM records:

>d1adql1 b.1.1.1 (L:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrppgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhavfgggtkltvlg

Timeline for d1adql1:

• d1adql1 first appeared (with stable ids) in SCOP 1.55
  
• d1adql1 appears in SCOP 1.73
  
• d1adql1 appears in SCOPe 2.01
  
• d1adql1 appears in the current release, SCOPe 2.08