SCOP 1.61: Domain d12e8p1: 12e8 P:1-114

Lineage for d12e8p1 (12e8 P:1-114)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)

8. Domain d12e8p1: 12e8 P:1-114 [20271]
   Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8p1

PDB Entry: 12e8, 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8p1:

Sequence; same for both SEQRES and ATOM records:

>d12e8p1 b.1.1.1 (P:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
a

Timeline for d12e8p1:

• d12e8p1 first appeared (with stable ids) in SCOP 1.55
  
• d12e8p1 appears in SCOP 1.59
  
• d12e8p1 appears in SCOP 1.63
  
• d12e8p1 appears in the current release, SCOPe 2.08