Lineage for d12e8p1 (12e8 P:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7395Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)
  8. 7399Domain d12e8p1: 12e8 P:1-114 [20271]
    Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8p1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment
PDB Compounds: (P:)

SCOP Domain Sequences for d12e8p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8p1 b.1.1.1 (P:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
a

SCOP Domain Coordinates for d12e8p1:

Click to download the PDB-style file with coordinates for d12e8p1.
(The format of our PDB-style files is described here.)

Timeline for d12e8p1: