Lineage for d4j5id_ (4j5i D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331086Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1331383Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 1331384Protein automated matches [191281] (4 species)
    not a true protein
  7. 1331391Species Mycobacterium smegmatis [TaxId:246196] [193240] (1 PDB entry)
  8. 1331395Domain d4j5id_: 4j5i D: [202702]
    automated match to d4j5ia_
    complexed with edo, fe, mg

Details for d4j5id_

PDB Entry: 4j5i (more details), 2.6 Å

PDB Description: crystal structure of an alpha-ketoglutarate-dependent taurine dioxygenase from mycobacterium smegmatis
PDB Compounds: (D:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d4j5id_:

Sequence, based on SEQRES records: (download)

>d4j5id_ b.82.2.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae
llgtptvahptlaegaeqllpidsrydkanswhtdvtfvdripkasllravtlpsyggtt
awasteaayqqlpaplrtladnlwavhtnrfdyadsaisaeqrgyrqrfesdyyevehpv
vrvhpetgervlllghfvksfvglkdtesaalfrlfqdritrlentvrwswkpgdlaiwd
nratqhyavadyddqyrrlnrvtlagdipvdvygersrviag

Sequence, based on observed residues (ATOM records): (download)

>d4j5id_ b.82.2.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae
llgtptanswhtdvtfvdripkasllravtlpsyggttawasteaayqqlpaplrtladn
lwavhtnrdyyevehpvvrvhpetgervlllghfvksfvglkdtesaalfrlfqdritrl
entvrwswkpgdlaiwdnratqhyavadyddqyrrlnrvtlagdipvdvygersrviag

SCOPe Domain Coordinates for d4j5id_:

Click to download the PDB-style file with coordinates for d4j5id_.
(The format of our PDB-style files is described here.)

Timeline for d4j5id_: