Lineage for d4j4gc_ (4j4g C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407676Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2407677Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2407678Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 2407679Protein Cyanovirin-N [51324] (1 species)
  7. 2407680Species Nostoc ellipsosporum [TaxId:45916] [51325] (18 PDB entries)
  8. 2407685Domain d4j4gc_: 4j4g C: [202697]
    automated match to d4j4db_

Details for d4j4gc_

PDB Entry: 4j4g (more details), 1.92 Å

PDB Description: Structure of P51G Cyanovirin-N swapped tetramer in the C2 space group
PDB Compounds: (C:) Cyanovirin-N

SCOPe Domain Sequences for d4j4gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4gc_ b.89.1.1 (C:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOPe Domain Coordinates for d4j4gc_:

Click to download the PDB-style file with coordinates for d4j4gc_.
(The format of our PDB-style files is described here.)

Timeline for d4j4gc_: