Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry) specific to the low density lipoprotein receptor binding region of apolipoprotein E |
Domain d12e8h1: 12e8 H:1-114 [20269] Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2 |
PDB Entry: 12e8 (more details), 1.9 Å
SCOP Domain Sequences for d12e8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d12e8h1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain} evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa a
Timeline for d12e8h1: