Lineage for d4j2ya_ (4j2y A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053956Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2053957Protein automated matches [190445] (6 species)
    not a true protein
  7. 2054000Species Enterolobium contortisiliquum [TaxId:55671] [197031] (2 PDB entries)
  8. 2054003Domain d4j2ya_: 4j2y A: [202687]
    Other proteins in same PDB: d4j2yb_
    automated match to d4j2ka_
    complexed with so4

Details for d4j2ya_

PDB Entry: 4j2y (more details), 2 Å

PDB Description: Crystal structure of a plant trypsin inhibitor EcTI in complex with bovine trypsin.
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d4j2ya_:

Sequence, based on SEQRES records: (download)

>d4j2ya_ b.42.4.0 (A:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkahr

Sequence, based on observed residues (ATOM records): (download)

>d4j2ya_ b.42.4.0 (A:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkehlfgsfkikp
yrddyklvycesckdlgisiddennrllvvkdgdplavrfvkahr

SCOPe Domain Coordinates for d4j2ya_:

Click to download the PDB-style file with coordinates for d4j2ya_.
(The format of our PDB-style files is described here.)

Timeline for d4j2ya_: