Lineage for d4j2kb_ (4j2k B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062411Species Enterolobium contortisiliquum [TaxId:55671] [197031] (2 PDB entries)
  8. 2062413Domain d4j2kb_: 4j2k B: [202686]
    automated match to d4j2ka_
    complexed with gol, imd

Details for d4j2kb_

PDB Entry: 4j2k (more details), 1.75 Å

PDB Description: crystal structure of a plant trypsin inhibitor ecti
PDB Compounds: (B:) trypsin inhibitor

SCOPe Domain Sequences for d4j2kb_:

Sequence, based on SEQRES records: (download)

>d4j2kb_ b.42.4.0 (B:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkah

Sequence, based on observed residues (ATOM records): (download)

>d4j2kb_ b.42.4.0 (B:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycesckdlgisiddennrllvvkdgdplavrfvkah

SCOPe Domain Coordinates for d4j2kb_:

Click to download the PDB-style file with coordinates for d4j2kb_.
(The format of our PDB-style files is described here.)

Timeline for d4j2kb_: