Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (6 species) not a true protein |
Species Enterolobium contortisiliquum [TaxId:55671] [197031] (2 PDB entries) |
Domain d4j2kb_: 4j2k B: [202686] automated match to d4j2ka_ complexed with gol, imd |
PDB Entry: 4j2k (more details), 1.75 Å
SCOPe Domain Sequences for d4j2kb_:
Sequence, based on SEQRES records: (download)
>d4j2kb_ b.42.4.0 (B:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]} kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkah
>d4j2kb_ b.42.4.0 (B:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]} kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk ikpyrddyklvycesckdlgisiddennrllvvkdgdplavrfvkah
Timeline for d4j2kb_: