SCOP 1.73: Domain d12e8l1: 12e8 L:1-107

Lineage for d12e8l1 (12e8 L:1-107)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
Domain d12e8l1: 12e8 L:1-107 [20268]
Other proteins in same PDB: d12e8h1, d12e8h2, d12e8l2, d12e8m2, d12e8p1, d12e8p2

Details for d12e8l1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

PDB Compounds: (L:) igg1-kappa 2e8 fab (light chain)

SCOP Domain Sequences for d12e8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelk

SCOP Domain Coordinates for d12e8l1:

Click to download the PDB-style file with coordinates for d12e8l1.
(The format of our PDB-style files is described here.)

Timeline for d12e8l1: