SCOP 1.63: Domain d12e8l1: 12e8 L:1-107

Lineage for d12e8l1 (12e8 L:1-107)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)
specific to the low density lipoprotein receptor binding region of apolipoprotein E
Domain d12e8l1: 12e8 L:1-107 [20268]
Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8l1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelk

SCOP Domain Coordinates for d12e8l1:

Click to download the PDB-style file with coordinates for d12e8l1.
(The format of our PDB-style files is described here.)

Timeline for d12e8l1: