SCOP 1.55: Domain d12e8l1: 12e8 L:1-107

Lineage for d12e8l1 (12e8 L:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)

8. Domain d12e8l1: 12e8 L:1-107 [20268]
   Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8l1

PDB Entry: 12e8, 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8l1:

Sequence; same for both SEQRES and ATOM records:

>d12e8l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelk

Timeline for d12e8l1:

• d12e8l1 appears in SCOP 1.57
  
• d12e8l1 appears in the current release, SCOPe 2.08