Lineage for d4ixwb_ (4ixw B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1828143Protein automated matches [190085] (47 species)
    not a true protein
  7. 1828495Species Rhizobium radiobacter [TaxId:358] [197100] (3 PDB entries)
  8. 1828501Domain d4ixwb_: 4ixw B: [202679]
    automated match to d4ixwa_
    complexed with cl, ixw

Details for d4ixwb_

PDB Entry: 4ixw (more details), 2.47 Å

PDB Description: halohydrin dehalogenase (hhec) bound to ethyl (2s)-oxiran-2-ylacetate
PDB Compounds: (B:) halohydrin dehalogenase

SCOPe Domain Sequences for d4ixwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixwb_ c.2.1.2 (B:) automated matches {Rhizobium radiobacter [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkhqdeleafaetypqlipmseqepve
lieavtsalghvdilvsndiapvewrpidkyavedyrdmvealqikpfalanavasqmkr
rksghiifitsaasfgpwkelstyasaragasalanalskelgehnipvfaiapngvdsg
dspyyypsepwktspehvawvrkytalqrlgtqkelgelvtflasgscdyltgqvfwlag
gfpvverwpg

SCOPe Domain Coordinates for d4ixwb_:

Click to download the PDB-style file with coordinates for d4ixwb_.
(The format of our PDB-style files is described here.)

Timeline for d4ixwb_: