Lineage for d4itza_ (4itz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1900227Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1900228Protein automated matches [191162] (23 species)
    not a true protein
  7. 1900307Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries)
  8. 1900310Domain d4itza_: 4itz A: [202677]
    automated match to d3ihza_
    complexed with so4

Details for d4itza_

PDB Entry: 4itz (more details), 1.65 Å

PDB Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35 in complex with a tetrapeptide substrate
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase

SCOPe Domain Sequences for d4itza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itza_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
leqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpfk
fhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisfr
e

SCOPe Domain Coordinates for d4itza_:

Click to download the PDB-style file with coordinates for d4itza_.
(The format of our PDB-style files is described here.)

Timeline for d4itza_: