SCOP 1.59: Domain d1g9nh1: 1g9n H:1-129

Lineage for d1g9nh1 (1g9n H:1-129)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)
Domain d1g9nh1: 1g9n H:1-129 [20267]
Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh2, d1g9nl2

Details for d1g9nh1

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nh1 b.1.1.1 (H:1-129) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeyrnngflkhwgq
gtlvtvtsa

SCOP Domain Coordinates for d1g9nh1:

Click to download the PDB-style file with coordinates for d1g9nh1.
(The format of our PDB-style files is described here.)

Timeline for d1g9nh1: