Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries) |
Domain d1g9nh1: 1g9n H:1-129 [20267] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh2, d1g9nl2 |
PDB Entry: 1g9n (more details), 2.9 Å
SCOP Domain Sequences for d1g9nh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nh1 b.1.1.1 (H:1-129) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeyrnngflkhwgq gtlvtvtsa
Timeline for d1g9nh1: