SCOP 1.59: Domain d1g9nl1: 1g9n L:1-109

Lineage for d1g9nl1 (1g9n L:1-109)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)

8. Domain d1g9nl1: 1g9n L:1-109 [20266]
   Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh2, d1g9nl2

Details for d1g9nl1

PDB Entry: 1g9n, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nl1:

Sequence; same for both SEQRES and ATOM records:

>d1g9nl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
eleltqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

Timeline for d1g9nl1:

• d1g9nl1 first appeared (with stable ids) in SCOP 1.55
  
• d1g9nl1 appears in SCOP 1.57
  
• d1g9nl1 appears in SCOP 1.61
  
• d1g9nl1 appears in the current release, SCOPe 2.08