Lineage for d1gc1h1 (1gc1 H:1-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739829Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 2739872Domain d1gc1h1: 1gc1 H:1-129 [20265]
    Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h2, d1gc1l1, d1gc1l2
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with nag

Details for d1gc1h1

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
PDB Compounds: (H:) antibody 17b

SCOPe Domain Sequences for d1gc1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1h1 b.1.1.1 (H:1-129) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvtsa

SCOPe Domain Coordinates for d1gc1h1:

Click to download the PDB-style file with coordinates for d1gc1h1.
(The format of our PDB-style files is described here.)

Timeline for d1gc1h1: