Lineage for d4inrp_ (4inr P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599604Domain d4inrp_: 4inr P: [202638]
    Other proteins in same PDB: d4inra_, d4inre_, d4inrf_, d4inri_, d4inrj_, d4inrk_, d4inrl_, d4inrm_, d4inrn_, d4inro_, d4inrs_, d4inrt_, d4inrw_, d4inrx_, d4inry_, d4inrz_
    automated match to d2zcyb_
    complexed with 1g1

Details for d4inrp_

PDB Entry: 4inr (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU102
PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d4inrp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inrp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4inrp_:

Click to download the PDB-style file with coordinates for d4inrp_.
(The format of our PDB-style files is described here.)

Timeline for d4inrp_: