SCOP 1.55: Domain d1g9mh1: 1g9m H:1-129

Lineage for d1g9mh1 (1g9m H:1-129)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)
Domain d1g9mh1: 1g9m H:1-129 [20263]
Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh2, d1g9ml2

Details for d1g9mh1

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9mh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9mh1 b.1.1.1 (H:1-129) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeyrnngflkhwgq
gtlvtvtsa

SCOP Domain Coordinates for d1g9mh1:

Click to download the PDB-style file with coordinates for d1g9mh1.
(The format of our PDB-style files is described here.)

Timeline for d1g9mh1: