Lineage for d4in6h2 (4in6 H:36-250)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061299Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2061300Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2061301Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2061420Protein automated matches [226918] (3 species)
    not a true protein
  7. 2061426Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)
  8. 2061429Domain d4in6h2: 4in6 H:36-250 [202624]
    Other proteins in same PDB: d4in6h1, d4in6l_, d4in6m_
    automated match to d1l9bh1
    complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant

Details for d4in6h2

PDB Entry: 4in6 (more details), 2.7 Å

PDB Description: (m)l214a mutant of the rhodobacter sphaeroides reaction center
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4in6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4in6h2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d4in6h2:

Click to download the PDB-style file with coordinates for d4in6h2.
(The format of our PDB-style files is described here.)

Timeline for d4in6h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4in6h1