![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein automated matches [226918] (2 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [225170] (5 PDB entries) |
![]() | Domain d4in6h2: 4in6 H:36-250 [202624] Other proteins in same PDB: d4in6h1, d4in6l_, d4in6m_ automated match to d1l9bh1 complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant |
PDB Entry: 4in6 (more details), 2.7 Å
SCOPe Domain Sequences for d4in6h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4in6h2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d4in6h2: