![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein automated matches [226918] (3 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries) |
![]() | Domain d4in5h2: 4in5 H:36-250 [202622] Other proteins in same PDB: d4in5h1, d4in5l_, d4in5m_ automated match to d1l9bh1 complexed with bcl, bph, fe, gol, hto, k, lda, pc1, po4, spo, u10; mutant |
PDB Entry: 4in5 (more details), 2.2 Å
SCOPe Domain Sequences for d4in5h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4in5h2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d4in5h2: