Lineage for d1g9ml1 (1g9m L:1-109)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930552Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 930588Domain d1g9ml1: 1g9m L:1-109 [20262]
    Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml2
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with ipa, nag, ndg

Details for d1g9ml1

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (L:) antibody 17b, light chain

SCOPe Domain Sequences for d1g9ml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ml1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eleltqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

SCOPe Domain Coordinates for d1g9ml1:

Click to download the PDB-style file with coordinates for d1g9ml1.
(The format of our PDB-style files is described here.)

Timeline for d1g9ml1: