Lineage for d1g9ml1 (1g9m L:1-109)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102968Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)
  8. 102970Domain d1g9ml1: 1g9m L:1-109 [20262]
    Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mg_, d1g9mh2, d1g9ml2

Details for d1g9ml1

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9ml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ml1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
eleltqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

SCOP Domain Coordinates for d1g9ml1:

Click to download the PDB-style file with coordinates for d1g9ml1.
(The format of our PDB-style files is described here.)

Timeline for d1g9ml1: