SCOPe 2.05: Domain d4ihjd1: 4ihj D:2-245

Lineage for d4ihjd1 (4ihj D:2-245)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries)

8. Domain d4ihjd1: 4ihj D:2-245 [202616]
   Other proteins in same PDB: d4ihja2, d4ihjb2, d4ihjc2, d4ihjd2, d4ihje_
   automated match to d1tubb1
   complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihjd1

PDB Entry: 4ihj, 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4ihjd1:

Sequence; same for both SEQRES and ATOM records:

>d4ihjd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d4ihjd1:

• d4ihjd1 first appeared in SCOPe 2.03
  
• d4ihjd1 appears in SCOPe 2.04
  
• d4ihjd1 appears in SCOPe 2.06
  
• d4ihjd1 appears in the current release, SCOPe 2.08