Lineage for d4ihjc1 (4ihj C:1-245)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592334Protein automated matches [226837] (3 species)
    not a true protein
  7. 1592335Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries)
  8. 1592338Domain d4ihjc1: 4ihj C:1-245 [202614]
    Other proteins in same PDB: d4ihja2, d4ihjb2, d4ihjc2, d4ihjd2, d4ihje_
    automated match to d1tuba1
    complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihjc1

PDB Entry: 4ihj (more details), 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4ihjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihjc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d4ihjc1:

Click to download the PDB-style file with coordinates for d4ihjc1.
(The format of our PDB-style files is described here.)

Timeline for d4ihjc1: