Lineage for d1a6vj_ (1a6v J:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7893Species Fv B1-8 (mouse), lambda L chain [48853] (3 PDB entries)
  8. 7900Domain d1a6vj_: 1a6v J: [20261]

Details for d1a6vj_

PDB Entry: 1a6v (more details), 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6vj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6vj_ b.1.1.1 (J:) Immunoglobulin (variable domains of L and H chains) {Fv B1-8 (mouse), lambda L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

SCOP Domain Coordinates for d1a6vj_:

Click to download the PDB-style file with coordinates for d1a6vj_.
(The format of our PDB-style files is described here.)

Timeline for d1a6vj_: