Lineage for d4ienc_ (4ien C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902586Species Neisseria meningitidis [TaxId:272831] [193287] (2 PDB entries)
  8. 1902589Domain d4ienc_: 4ien C: [202609]
    automated match to d4iend_
    complexed with cl, coa, gdp

Details for d4ienc_

PDB Entry: 4ien (more details), 2 Å

PDB Description: crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18
PDB Compounds: (C:) Putative acyl-CoA hydrolase

SCOPe Domain Sequences for d4ienc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ienc_ d.38.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 272831]}
rqlpshelimselmmpdtanfsgnvhggellllldqvayscasrysgnycvtlsvdkvlf
kepihigdlvtfyaavnytgrtsmeigirveaqnirtgeirhtnscyftmvavkdgkpvp
vppleiltdrqrcryekakkrrdislqasedmsc

SCOPe Domain Coordinates for d4ienc_:

Click to download the PDB-style file with coordinates for d4ienc_.
(The format of our PDB-style files is described here.)

Timeline for d4ienc_: