Lineage for d4i9yb_ (4i9y B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325683Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1325684Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1325685Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1325926Protein automated matches [190077] (16 species)
    not a true protein
  7. 1325946Species Human (Homo sapiens) [TaxId:9606] [186915] (14 PDB entries)
  8. 1325953Domain d4i9yb_: 4i9y B: [202596]
    automated match to d4i9ya_
    complexed with cl, gol, tla

Details for d4i9yb_

PDB Entry: 4i9y (more details), 1.75 Å

PDB Description: structure of the c-terminal domain of nup358
PDB Compounds: (B:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4i9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9yb_ b.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gphmtnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrvi
pdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitlk
kaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

SCOPe Domain Coordinates for d4i9yb_:

Click to download the PDB-style file with coordinates for d4i9yb_.
(The format of our PDB-style files is described here.)

Timeline for d4i9yb_: