Lineage for d4i83f_ (4i83 F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410619Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1410620Protein automated matches [190143] (19 species)
    not a true protein
  7. 1410681Species Neisseria meningitidis [TaxId:272831] [193287] (2 PDB entries)
  8. 1410691Domain d4i83f_: 4i83 F: [202589]
    automated match to d4i83c_

Details for d4i83f_

PDB Entry: 4i83 (more details), 2.6 Å

PDB Description: crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18
PDB Compounds: (F:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d4i83f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i83f_ d.38.1.0 (F:) automated matches {Neisseria meningitidis [TaxId: 272831]}
vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
igkfnavakvdgqvaveaiimcak

SCOPe Domain Coordinates for d4i83f_:

Click to download the PDB-style file with coordinates for d4i83f_.
(The format of our PDB-style files is described here.)

Timeline for d4i83f_: